PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676734994
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family NF-YB
Protein Properties Length: 156aa    MW: 17643.8 Da    PI: 6.8789
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676734994genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB173.71.9e-5446141297
      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa+a+lGf+dy+e+lk+yl++yr +ege+
  676734994  46 KEQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWAMANLGFDDYAEQLKKYLNRYRVIEGER 141
                89*******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.6E-5338148IPR009072Histone-fold
SuperFamilySSF471139.01E-4048149IPR009072Histone-fold
PfamPF008085.5E-2851115IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.4E-197997No hitNo description
PROSITE patternPS0068508298IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.4E-1998116No hitNo description
PRINTSPR006151.4E-19117135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MAGNYPSFQN PMPGFQNYNF ASSSSHHQHH GLVVEDQQQE ESMMIKEQDR LLPIANVGRI  60
MKNILPPNAK ISKEAKETMQ ECVSEFISFV TGEASDKCHK EKRKTVNGDD ICWAMANLGF  120
DDYAEQLKKY LNRYRVIEGE RANHHGKGGA KSSPDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-4545135191Transcription factor HapC (Eurofung)
4g92_B5e-4545135191Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7876651e-159KC787665.1 Brassica napus transcription factor subunit NF-YB5 (NF-YB5) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626976.11e-102PREDICTED: nuclear transcription factor Y subunit B-5-like
SwissprotO822481e-101NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A0D3B7551e-102A0A0D3B755_BRAOL; Uncharacterized protein
STRINGBra000462.1-P8e-99(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25528229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.11e-102nuclear factor Y, subunit B5